Description : |
This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. |
Protein length : |
333 amino acids |
Molecular Weight : |
62.700kDa inclusive of tags |
Source : |
Wheat germ |
Tissue specificity : |
Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues. |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNST WAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKE VAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQ KFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQ RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLA LWYMRRRSYQNIP |
Sequence Similarities : |
Contains 1 Ig-like (immunoglobulin-like) domain. |