"CD1B" Related Products

Expand
Expand

Recombinant Human CD1B

Cat.No.: CD1B-27865TH
Product Overview: Recombinant full length Human CD1b (amino acids 1-333) with N terminal proprietary tag, 62.7kDa.
Description: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens.
Protein length: 333 amino acids
Molecular Weight: 62.700kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNST WAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKE VAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQ KFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQ RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLA LWYMRRRSYQNIP
Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.
Gene Name: CD1B CD1b molecule [ Homo sapiens ]
Official Symbol: CD1B
Synonyms: CD1B; CD1b molecule; CD1, CD1b antigen , CD1B antigen, b polypeptide; T-cell surface glycoprotein CD1b;
Gene ID: 910
mRNA Refseq: NM_001764
Protein Refseq: NP_001755
MIM: 188360
Uniprot ID: P29016
Chromosome Location: 1q22-q23
Pathway: Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.