"CEACAM8" Related Products

Expand
Expand

Recombinant Human CEACAM8

Cat.No.: CEACAM8-27504TH
Product Overview: Recombinant full length Human CD66b with N terminal proprietary tag; Predicted MWt 64.39 kDa.
Description: Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) also known as CD66b (Cluster of Differentiation 66b), is a human gene.
Protein length: 349 amino acids
Molecular Weight: 64.390kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEA VPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRII GYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSY TLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDK DAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTL TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAP TISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQY TQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD ALVQGSSPGLSARATVSIMIGVLARVALI
Sequence Similarities: Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ]
Official Symbol: CEACAM8
Synonyms: CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b;
Gene ID: 1088
mRNA Refseq: NM_001816
Protein Refseq: NP_001807
Uniprot ID: P31997
Chromosome Location: 19q13.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.