"CRY1" Related Products

Expand
Expand
Expand

Recombinant Human CRY1

Cat.No.: CRY1-26414TH
Product Overview: Recombinant full length Human Cryptochrome I with a N terminal proprietary tag; predicted MWt 90.2 kDa inclusive of tag. AAH30519
Description: Cryptochromes are a class of blue light-sensitive flavoproteins found in plants and animals.
Protein length: 586 amino acids
Molecular Weight: 90.200kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPW FAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQP ADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKM EPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF DTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNS SPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPW DKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWL SCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFP AKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAEN IPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTG LSGGKRPSQEEDTQSIGPKVQRQSTN
Sequence Similarities: Belongs to the DNA photolyase class-1 family.Contains 1 DNA photolyase domain.
Gene Name: CRY1 cryptochrome 1 (photolyase-like) [ Homo sapiens ]
Official Symbol: CRY1
Synonyms: CRY1; cryptochrome 1 (photolyase-like); PHLL1; cryptochrome-1;
Gene ID: 1407
mRNA Refseq: NM_004075
Protein Refseq: NP_004066
MIM: 601933
Uniprot ID: Q16526
Chromosome Location: 12q23-q24.1
Pathway: BMAL1:CLOCK/NPAS2 Activates Gene Expression, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem;
Function: NOT DNA (6-4) photolyase activity; DNA binding; blue light photoreceptor activity; NOT deoxyribodipyrimidine photo-lyase activity; double-stranded DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.