"CSF3" Related Products

Recombinant Human CSF3

Cat.No.: CSF3-26467TH
Product Overview: Recombinant full length human G-CSF protein expressed in modified human 293 cells.
Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene.
Biological activity: The ED50 of CSF3-26467TH is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence:ATPLGPASSLPQSFLLKCLEQVRKIQGDG AALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPS QALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTL QLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAF QRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Sequence Similarities: Belongs to the IL-6 superfamily.
Gene Name: CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
Official Symbol: CSF3
Synonyms: CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin;
Gene ID: 1440
mRNA Refseq: NM_000759
Protein Refseq: NP_000750
MIM: 138970
Uniprot ID: P09919
Chromosome Location: 17q11.2-q12
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.