Recombinant Human CSF3
Cat.No. : | CSF3-26467TH |
Product Overview : | Recombinant full length human G-CSF protein expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. |
Biological activity : | The ED50 of CSF3-26467TH is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:ATPLGPASSLPQSFLLKCLEQVRKIQGDG AALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPS QALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTL QLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAF QRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Sequence Similarities : | Belongs to the IL-6 superfamily. |
Gene Name : | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ] |
Official Symbol : | CSF3 |
Synonyms : | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; |
Gene ID : | 1440 |
mRNA Refseq : | NM_000759 |
Protein Refseq : | NP_000750 |
MIM : | 138970 |
Uniprot ID : | P09919 |
Chromosome Location : | 17q11.2-q12 |
Pathway : | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function : | cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity; |
Products Types
◆ Recombinant Protein | ||
CSF3-49H | Active Recombinant Human CSF3 Protein | +Inquiry |
CSF3-30H | Active Recombinant Human CSF3 Protein (Thr31-Pro204), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CSF3-4407C | Recombinant Chicken CSF3 Protein | +Inquiry |
CSF3-341C | Active Recombinant Human CSF3 Protein | +Inquiry |
Csf3-046M | Active Recombinant Mouse Csf3 Protein | +Inquiry |
◆ Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket