"CXADR" Related Products

Expand
Expand
Expand

Recombinant Human CXADR

Cat.No.: CXADR-27584TH
Product Overview: Recombinant full length Human Coxsackie Adenovirus Receptor with an N terminal proprietary tag; Predicted MWt 66.26 kDa.
Description: The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Several transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene are found on chromosomes 15, 18, and 21.
Protein length: 365 amino acids
Molecular Weight: 66.260kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is found at the neuromusc
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLP CKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIY DDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI KCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVK NASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIRED VPPPKSRTSTARSYIGGNHSSLGSMSPSNMEGYSKTQYNQ VPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK DGSIV
Sequence Similarities: Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name: CXADR coxsackie virus and adenovirus receptor [ Homo sapiens ]
Official Symbol: CXADR
Synonyms: CXADR; coxsackie virus and adenovirus receptor; coxsackievirus and adenovirus receptor; CAR;
Gene ID: 1525
mRNA Refseq: NM_001207063
Protein Refseq: NP_001193992
MIM: 602621
Uniprot ID: P78310
Chromosome Location: 21q21.1
Pathway: Adaptive Immune System, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;
Function: PDZ domain binding; beta-catenin binding; cell adhesion molecule binding; connexin binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.