Recombinant Human CXCL6 CXCL6-27781TH

Recombinant Human CXCL6

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CXCL6

Recombinant Human CXCL6

CXCL6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CXCL6-27781TH
Product Overview : Highly pure (>98%) recombinant human GCP2.
Description : Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family that is also known as granulocyte chemotactic protein 2 (GCP-2). As its former name suggests, CXCL6 is a chemoattractant for neutrophilic granulocytes.
Source : E. coli
Form : Lyophilised
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human GCP-2 is an 8.0 kDa protein containing 73 amino acid residues:VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNG KQVCLDPEAPFLKKVIQKILDSGNKKN
Sequence Similarities : Belongs to the intercrine alpha (chemokine CxC) family.
Gene Name : CXCL6 chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) [ Homo sapiens ]
Official Symbol : CXCL6
Synonyms : CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2;
Gene ID : 6372
mRNA Refseq : NM_002993
Protein Refseq : NP_002984
MIM : 138965
Uniprot ID : P80162
Chromosome Location : 4q13.3
Pathway : Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function : chemokine activity; heparin binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy