"CXCL6" Related Products

Expand
Expand

Recombinant Human CXCL6

Cat.No.: CXCL6-27781TH
Product Overview: Highly pure (>98%) recombinant human GCP2.
Description: Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family that is also known as granulocyte chemotactic protein 2 (GCP-2). As its former name suggests, CXCL6 is a chemoattractant for neutrophilic granulocytes.
Source: E. coli
Form: Lyophilised
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Human GCP-2 is an 8.0 kDa protein containing 73 amino acid residues:VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNG KQVCLDPEAPFLKKVIQKILDSGNKKN
Sequence Similarities: Belongs to the intercrine alpha (chemokine CxC) family.
Gene Name: CXCL6 chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) [ Homo sapiens ]
Official Symbol: CXCL6
Synonyms: CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2;
Gene ID: 6372
mRNA Refseq: NM_002993
Protein Refseq: NP_002984
MIM: 138965
Uniprot ID: P80162
Chromosome Location: 4q13.3
Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function: chemokine activity; heparin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.