Recombinant Human DAP
Cat.No. : | DAP-27364TH |
Product Overview : | Recombinant full length Human DAP1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. |
Protein length : | 102 amino acids |
Molecular Weight : | 36.960kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEK DKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQ KPHASMDKHPSPRTQHIQQPRK |
Gene Name : | DAP death-associated protein [ Homo sapiens ] |
Official Symbol : | DAP |
Synonyms : | DAP; death-associated protein; death-associated protein 1; |
Gene ID : | 1611 |
mRNA Refseq : | NM_004394 |
Protein Refseq : | NP_004385 |
MIM : | 600954 |
Uniprot ID : | P51397 |
Chromosome Location : | 5p15.2 |
Pathway : | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function : | death domain binding; |
Products Types
◆ Recombinant Protein | ||
DAP-1000R | Recombinant Rhesus Macaque DAP Protein, His (Fc)-Avi-tagged | +Inquiry |
Dap-1308R | Recombinant Rat Dap Protein, His-tagged | +Inquiry |
DAP-2332H | Recombinant Human DAP Protein, GST-tagged | +Inquiry |
DAP-1432R | Recombinant Rat DAP Protein, His (Fc)-Avi-tagged | +Inquiry |
DAP-892H | Recombinant Human DAP Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
DAP-7078HCL | Recombinant Human DAP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket