Recombinant Human DNAJC9, His-tagged
Cat.No. : | DNAJC9-26775TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-178 of Human DNAJC9 with an N terminal His tag. Predicted MWt: 22 kDa; |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 126 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSL QVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVY DEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAF EKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEE PRIRNIIQQAIDAGEVPSYNAF |
Sequence Similarities : | Contains 1 J domain. |
Gene Name : | DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens ] |
Official Symbol : | DNAJC9 |
Synonyms : | DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; |
Gene ID : | 23234 |
mRNA Refseq : | NM_015190 |
Protein Refseq : | NP_056005 |
MIM : | 611206 |
Uniprot ID : | Q8WXX5 |
Chromosome Location : | 10q22.3 |
Function : | heat shock protein binding; unfolded protein binding; |
Products Types
◆ Recombinant Protein | ||
DNAJC9-1357H | Recombinant Human DNAJC9 Protein, His-tagged | +Inquiry |
DNAJC9-2458M | Recombinant Mouse DNAJC9 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC9-426H | Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNAJC9-2770H | Recombinant Human DNAJC9 Protein, GST-tagged | +Inquiry |
Dnajc9-378M | Recombinant Mouse Dnajc9 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket