"DSG1" Related Products

Expand
Expand

Recombinant Human DSG1

Cat.No.: DSG1-26581TH
Product Overview: Recombinant full length Human Desmoglein 1 with N terminal proprietary tag; Predicted MWt 142.39 kDa inclusive of tag.
Description: Desmosomes are cell-cell junctions between epithelial, myocardial and certain other cell types. Desmoglein 1 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. The protein encoded by this gene has been identified as the autoantigen of the autoimmune skin blistering disease pemphigus foliaceus.
Protein length: 1049 amino acids
Molecular Weight: 142.390kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Epidermis, tongue, tonsil and esophagus.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIK WHSIRRQKREWIKFAAACREGEDNSKRNPIAKIHSDCAAN QQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVT PFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMA TFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIR QEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGS DRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQE NTLNSNLLEIRVIDLDEEFSANWMAVIFFISGNEGNWFEI EMNERTNVGILKVVKPLDYEAMQSLQLSIGVRNKAEFHHS IMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGS NDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTG KLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTIN INIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTT STDSSQVYSSEPGNGAKDLLSDNVHFGPAGIGLLIMGFLV LGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVE GPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGR EMQDLGGGERMTGFELTEGVKTSGMPEICQEYSGTLRRNS MRECREGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLI YDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLAD ISLGKESYPDLDPSWPPQSTEPVCLPQETEPVVSGHPPIS PHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTES YTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGM LEMPDLRDGSNVIVTERVIAPSSSLPTSLTIHHPRESSNV VVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAG VTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGG IGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRIT KYSTVQYSK
Sequence Similarities: Contains 4 cadherin domains.
Gene Name: DSG1 desmoglein 1 [ Homo sapiens ]
Official Symbol: DSG1
Synonyms: DSG1; desmoglein 1; DSG; desmoglein-1; CDHF4;
Gene ID: 1828
mRNA Refseq: NM_001942
Protein Refseq: NP_001933
MIM: 125670
Uniprot ID: Q02413
Chromosome Location: 18q12.1
Pathway: Apoptosis, organism-specific biosystem; Apoptotic cleavage of cell adhesionproteins, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Staphylococcus aureus infection, organism-specific biosystem;
Function: calcium ion binding; gamma-catenin binding; toxin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.