Recombinant Human DTNBP1, His-tagged
Cat.No. : | DTNBP1-26932TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-351 of Human Dysbindin with an N terminal His tag. Predicted mwt: 40 kDa; |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 85 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVP FLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDS EVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTA NLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQ LENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKE RQKFFEEAFQQDMEQYLSTGYLQIAERREPIGSMSSME VNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPAL GPESSTCQNEITLQVPNPSELRAKPPSSSSTCTDSATR DISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGG EDSDS |
Gene Name : | DTNBP1 dystrobrevin binding protein 1 [ Homo sapiens ] |
Official Symbol : | DTNBP1 |
Synonyms : | DTNBP1; dystrobrevin binding protein 1; dysbindin; DBND; Dysbindin; HPS7; My031; |
Gene ID : | 84062 |
mRNA Refseq : | NM_032122 |
Protein Refseq : | NP_115498 |
MIM : | 607145 |
Uniprot ID : | Q96EV8 |
Chromosome Location : | 6p22.3 |
Pathway : | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
DTNBP1-1625R | Recombinant Rat DTNBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DTNBP1-2902H | Recombinant Human DTNBP1 Protein, GST-tagged | +Inquiry |
DTNBP1-2546M | Recombinant Mouse DTNBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dtnbp1-2672M | Recombinant Mouse Dtnbp1 Protein, Myc/DDK-tagged | +Inquiry |
Dtnbp1-682M | Recombinant Mouse Dtnbp1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
DTNBP1-6796HCL | Recombinant Human DTNBP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket