"DUT" Related Products

Expand
Expand

Recombinant Human DUT, His-tagged

Cat.No.: DUT-27878TH
Product Overview: Recombinant full length Human DUT-N with an N terminal His tag; 204 amino acids with tag, Predicted MWt 21.6 kDa.
Description: This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.
Protein length: 183 amino acids
Conjugation: HIS
Molecular Weight: 21.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Found in a variety of tissues.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Sequence Similarities: Belongs to the dUTPase family.
Gene Name: DUT deoxyuridine triphosphatase [ Homo sapiens ]
Official Symbol: DUT
Synonyms: DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase;
Gene ID: 1854
mRNA Refseq: NM_001025248
Protein Refseq: NP_001020419
MIM: 601266
Uniprot ID: P33316
Chromosome Location: 15q21.1
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem;
Function: dUTP diphosphatase activity; hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.