"DVL3" Related Products

Expand
Expand

Recombinant Human DVL3

Cat.No.: DVL3-28353TH
Product Overview: Recombinant full length Human Dishevelled 3 with a N terminal proprietary tag: predicted molecular weight 104.83 kDa inclusive of tag.
Description: This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
Protein length: 716 amino acids
Molecular Weight: 104.830kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRP SYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVS AEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNG TAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSR FSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGS IMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLR EIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTER LDDFHLSIHSDMAAIVKAMASPESGLEVRDRMLLKITIPN AFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDT LAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSY GGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSL ASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPG APPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
Sequence Similarities: Belongs to the DSH family.Contains 1 DEP domain.Contains 1 DIX domain.Contains 1 PDZ (DHR) domain.
Gene Name: DVL3 dishevelled, dsh homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol: DVL3
Synonyms: DVL3; dishevelled, dsh homolog 3 (Drosophila); dishevelled 3 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-3; KIAA0208;
Gene ID: 1857
mRNA Refseq: NM_004423
Protein Refseq: NP_004414
MIM: 601368
Uniprot ID: Q92997
Chromosome Location: 3q27
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; HTLV-I infection, organism-specific biosystem;
Function: beta-catenin binding; frizzled binding; protease binding; protein binding; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.