Recombinant Human EDF1, His-tagged
| Cat.No. : | EDF1-28461TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-148 of Human EDF1 with N terminal His tag, 25kDa. |
- Specification
- Gene Information
- Related Products
| Description : | This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. |
| Conjugation : | HIS |
| Source : | E. coli |
| Tissue specificity : | Expressed in brain, liver, lung, kidney and heart (at protein level). Ubiquitously expressed. More abundant in heart, pancreas, liver, intestine and adipose tissues. |
| Form : | Lyophilised:Reconstitute with 48 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
| Sequences of amino acids : | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVET SKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVG KVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNN QVLGKIERAIGLKLRGKDIGKPIEKGPRAK |
| Sequence Similarities : | Contains 1 HTH cro/C1-type DNA-binding domain. |
| Gene Name : | EDF1 endothelial differentiation-related factor 1 [ Homo sapiens ] |
| Official Symbol : | EDF1 |
| Synonyms : | EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; |
| Gene ID : | 8721 |
| mRNA Refseq : | NM_003792 |
| Protein Refseq : | NP_003783 |
| MIM : | 605107 |
| Uniprot ID : | O60869 |
| Chromosome Location : | 9q34.3 |
| Function : | calmodulin binding; NOT histone acetyltransferase activity; NOT methyltransferase activity; protein binding; sequence-specific DNA binding; |
Products Types
| ◆ Recombinant Protein | ||
| EDF1-3052H | Recombinant Human EDF1 Protein, GST-tagged | +Inquiry |
| EDF1-108H | Recombinant Human EDF1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Edf1-2727M | Recombinant Mouse Edf1 Protein, Myc/DDK-tagged | +Inquiry |
| EDF1-1204R | Recombinant Rhesus Macaque EDF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EDF1-1379R | Recombinant Rhesus monkey EDF1 Protein, His-tagged | +Inquiry |
| ◆ Lysates | ||
| EDF1-6723HCL | Recombinant Human EDF1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
