Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human EIF5A, His-tagged

Cat.No. : EIF5A-27179TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-154 of Human eIF5A with an N terminal His tag. Predicted MWt: 18 kDa,
  • Specification
  • Gene Information
  • Related Products
Description : Eukaryotic translation initiation factor 5A-1 is a protein that in humans is encoded by the EIF5A gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).
Form : Lyophilised:Reconstitute with 67 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Thiourea, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKI VEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHN MDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPE GDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Sequence Similarities : Belongs to the eIF-5A family.
Gene Name : EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ]
Official Symbol : EIF5A
Synonyms : EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255;
Gene ID : 1984
mRNA Refseq : NM_001143760
Protein Refseq : NP_001137232
MIM : 600187
Uniprot ID : P63241
Chromosome Location : 17p13-p12
Pathway : Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Translation Factors, organism-specific biosystem;
Function : RNA binding; U6 snRNA binding; protein N-terminus binding; protein binding; ribosome binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All EIF5A Products

Required fields are marked with *

My Review for All EIF5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends