"ENO1" Related Products

Expand
Expand
Expand

Recombinant Human ENO1

Cat.No.: ENO1-28561TH
Product Overview: Recombinant full length Human ENO1 expressed in Saccharomyces cerevisiae; 434 amino acids, MWt 47.1 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy.
Tissue specificity: The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGAS TGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALV SKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGG SHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKN VIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYIS PDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTAS AGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGL CTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGR NFRNPLAK
Sequence Similarities: Belongs to the enolase family.
Gene Name: ENO1 enolase 1, (alpha) [ Homo sapiens ]
Official Symbol: ENO1
Synonyms: ENO1; enolase 1, (alpha); ENO1L1, MPB1; alpha-enolase; c-myc promoter-binding protein-1; MBP 1; PPH;
Gene ID: 2023
mRNA Refseq: NM_001201483
Protein Refseq: NP_001188412
MIM: 172430
Uniprot ID: P06733
Chromosome Location: 1p36.2
Pathway: Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem;
Function: DNA binding; lyase activity; magnesium ion binding; phosphopyruvate hydratase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.