"ETHE1" Related Products

Expand
Expand

Recombinant Human ETHE1, His-tagged

Cat.No.: ETHE1-28406TH
Product Overview: Recombinant fragment, corresponding to amino acids 23-239 of Human ETHE1 with an N terminal His tag. Observed mwt: 25 kDa ;
Description: This gene encodes a sulfur dioxygenase that localizes within the mitochondrial matrix. The enzyme functions in sulfide catabolism. Mutations in this gene result in ethylmalonic encephalopathy.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitously expressed.
Form: Lyophilised:Reconstitute with 117 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDA QLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQS VISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSV HEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLT LSCEEFVKIMGNLNLPKPQQIDF
Sequence Similarities: Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family.
Gene Name: ETHE1 ethylmalonic encephalopathy 1 [ Homo sapiens ]
Official Symbol: ETHE1
Synonyms: ETHE1; ethylmalonic encephalopathy 1; protein ETHE1, mitochondrial; HSCO; YF13H12;
Gene ID: 23474
mRNA Refseq: NM_014297
Protein Refseq: NP_055112
MIM: 608451
Uniprot ID: O95571
Chromosome Location: 19q13.32
Function: hydrolase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.