Recombinant Human ETS1
Cat.No. : | ETS1-28335TH |
Product Overview : | Recombinant full length Human ETS1 with N terminal proprietary tag; Predicted MWt 74.58 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Protein length : | 441 amino acids |
Molecular Weight : | 74.580kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPS SKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDW VMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFI SYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLK YENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPV IPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKN IIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD E |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain.Contains 1 PNT (pointed) domain. |
Gene Name : | ETS1 v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) [ Homo sapiens ] |
Official Symbol : | ETS1 |
Synonyms : | ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768; |
Gene ID : | 2113 |
mRNA Refseq : | NM_001143820 |
Protein Refseq : | NP_001137292 |
MIM : | 164720 |
Uniprot ID : | P14921 |
Chromosome Location : | 11q23.3 |
Pathway : | Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; BCR signaling pathway, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem; |
Function : | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
ETS1-3527H | Recombinant Human ETS1 Protein, GST-tagged | +Inquiry |
ETS1-872H | Recombinant Human ETS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ets1-2882M | Recombinant Mouse Ets1 Protein, Myc/DDK-tagged | +Inquiry |
ETS1-1819R | Recombinant Rat ETS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ets1-1647M | Recombinant Mouse Ets1 protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
ETS1-6526HCL | Recombinant Human ETS1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket