Recombinant Human FAM50A, His-tagged
Cat.No. : | FAM50A-28823TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-309 of Human FAM50A with N terminal His tag; MWt 35kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 101 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNI DKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKE REKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLS FTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKN PDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEI EITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKD FSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGK SGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLR |
Gene Name : | FAM50A family with sequence similarity 50, member A [ Homo sapiens ] |
Official Symbol : | FAM50A |
Synonyms : | FAM50A; family with sequence similarity 50, member A; protein FAM50A; 9F; DNA segment on chromosome X (unique) 9928 expressed sequence; DXS9928E; HXC 26; XAP5; |
Gene ID : | 9130 |
mRNA Refseq : | NM_004699 |
Protein Refseq : | NP_004690 |
MIM : | 300453 |
Uniprot ID : | Q14320 |
Chromosome Location : | Xq28 |
Function : | molecular_function; |
Products Types
◆ Recombinant Protein | ||
FAM50A-348H | Recombinant Human FAM50A Protein, MYC/DDK-tagged | +Inquiry |
FAM50A-3774H | Recombinant Human FAM50A Protein, GST-tagged | +Inquiry |
FAM50A-3064M | Recombinant Mouse FAM50A Protein, His (Fc)-Avi-tagged | +Inquiry |
Fam50a-371M | Recombinant Mouse Fam50a Protein, MYC/DDK-tagged | +Inquiry |
FAM50A-12708H | Recombinant Human FAM50A, His-tagged | +Inquiry |
◆ Lysates | ||
FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All FAM50A Products
Required fields are marked with *
My Review for All FAM50A Products
Required fields are marked with *
0
Inquiry Basket