Recombinant Human FBN2

• Cat.No.: FBN2-28840TH
• Product Overview: Recombinant fragment of Human Fibrillin 2 (amino acids 2776-2876) with proprietary tag at the N terminal; Predicted MW 36.74 kDa.

Specification

• Description: The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly.
• Protein length: 101 amino acids
• Molecular Weight: 36.740kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSK EHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSY LHTAKKKLMPGTYTLEITSIP
• Sequence Similarities: Belongs to the fibrillin family.Contains 47 EGF-like domains.Contains 9 TB (TGF-beta binding) domains.

Gene Information

• Gene Name: FBN2 fibrillin 2 [ Homo sapiens ]
• Official Symbol: FBN2
• Synonyms: FBN2; fibrillin 2; CCA, congenital contractural arachnodactyly; fibrillin-2; DA9; fibrillin 5
• Gene ID: 2201
• mRNA Refseq: NM_001999
• Protein Refseq: NP_001990
• MIM: 612570
• Uniprot ID: P35556
• Chromosome Location: 5q23-q31
• Function: binding; calcium ion binding; extracellular matrix structural constituent