"FBXO18" Related Products

Recombinant Human FBXO18, His-tagged

Cat.No.: FBXO18-28815TH
Product Overview: Recombinant fragment, corresponding to amino acids 520-1043 of Human FBXO18 with N terminal His tag; 524 amino acids, 61kDa.
Description: This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. It contains an F-box motif and seven conserved helicase motifs, and has both DNA-dependent ATPase and DNA unwinding activities. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GRKYQSKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKT LENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLN GVLEASRLWDNMRKLGECTEEAHQMTHDGYLKLWQLSKPS LASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQ QIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGA TILDVCKRVRKKTLVGGNHQSGIRGDAKGQVALLSRTNAN VFDEAVRVTEGEFPSRIHLIGGIKSFGLDRIIDIWILL QPEEERRKQNLVIKDKFIRRWVHKEGFSGFKRYVTAAE DKELEAKIAVVEKYNIRIPELVQRIEKCHIEDLDFAEYIL GTVHKAKGLEFDTVHVLDDFVKVPCARHNLPQLPHFRV ESFSEDEWNLLYVAVTRAKKRLIMTKSLENILTLAGEY FLQAELTSNVLKTGVVRCCVGQCNNAIPVDTVLTMKKLPI TYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVRAM ERTVENIVLPRHEALLFLVF
Gene Name: FBXO18 F-box protein, helicase, 18 [ Homo sapiens ]
Official Symbol: FBXO18
Synonyms: FBXO18; F-box protein, helicase, 18; F box only protein 18; F-box only protein 18; FBH1; Fbx18; FLJ14590;
Gene ID: 84893
mRNA Refseq: NM_032807
Protein Refseq: NP_116196
MIM: 607222
Uniprot ID: Q8NFZ0
Chromosome Location: 10p15.1
Function: ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.