Recombinant Human FBXO31, His-tagged
Cat.No. : | FBXO31-28814TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 298-539 of Human FBXO31 with an N terminal His tag. Predicted MWt: 28 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Members of the F-box protein family, such as FBXO31, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Highly expressed in brain. Expressed at moderate levels in most tissues, except bone marrow. |
Form : | Lyophilised:Reconstitute with 138 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNI PAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRE RVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPS KGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVG VSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILF DEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDE MLKNIQSLTS |
Sequence Similarities : | Belongs to the FBXO31 family.Contains 1 F-box domain. |
Gene Name : | FBXO31 F-box protein 31 [ Homo sapiens ] |
Official Symbol : | FBXO31 |
Synonyms : | FBXO31; F-box protein 31; F box only protein 31; F-box only protein 31; FBX14; Fbx31; FBXO14; MGC15419; |
Gene ID : | 79791 |
mRNA Refseq : | NM_024735 |
Protein Refseq : | NP_079011 |
MIM : | 609102 |
Uniprot ID : | Q5XUX0 |
Chromosome Location : | 16q24 |
Function : | cyclin binding; |
Products Types
◆ Recombinant Protein | ||
FBXO31-3934H | Recombinant Human FBXO31 Protein, GST-tagged | +Inquiry |
FBXO31-3159M | Recombinant Mouse FBXO31 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO31-1486R | Recombinant Rhesus Macaque FBXO31 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO31-1951R | Recombinant Rat FBXO31 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fbxo31-2967M | Recombinant Mouse Fbxo31 Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
FBXO31-6298HCL | Recombinant Human FBXO31 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket