Recombinant Human FCAR

• Cat.No.: FCAR-27894TH
• Product Overview: Recombinant fragment of Human CD89 with N terminal proprietary tag, 37.73kDa inclusive of tag.

Specification

• Description: This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells. Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar macrophages; however
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMII KNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYR IGHYRFRYSDTLELVVTGLYGKPFLSADRG
• Sequence Similarities: Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Gene Information

• Gene Name: FCAR Fc fragment of IgA, receptor for [ Homo sapiens ]
• Official Symbol: FCAR
• Synonyms: FCAR; Fc fragment of IgA, receptor for; immunoglobulin alpha Fc receptor; CD89
• Gene ID: 2204
• mRNA Refseq: NM_002000
• Protein Refseq: NP_001991
• MIM: 147045
• Uniprot ID: P24071
• Chromosome Location: 19q13.42
• Pathway: Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Staphylococcus aureus infection, organism-specific biosystem; Staphylococcus aureus infection, conserved biosystem
• Function: IgA binding; receptor activity