"FDFT1" Related Products

Expand
Expand

Recombinant Human FDFT1

Cat.No.: FDFT1-27574TH
Product Overview: Recombinant full length Human FDFT1 with an N-terminal proprietary tag; 71.98 kDa.
Description: This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.
Protein length: 417 amino acids
Molecular Weight: 71.980kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEFVKCLGHPEEFYNLVRFRVGGKRKVMPKMDQDSLSSSL KTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALD TLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQ VLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDK HVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGED TERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYV KKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRL RNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQ AVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTR QIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQY LTTLSQVTEDYVQTGEH
Sequence Similarities: Belongs to the phytoene/squalene synthase family.
Gene Name: FDFT1 farnesyl-diphosphate farnesyltransferase 1 [ Homo sapiens ]
Official Symbol: FDFT1
Synonyms: FDFT1; farnesyl-diphosphate farnesyltransferase 1; squalene synthase;
Gene ID: 2222
mRNA Refseq: NM_004462
Protein Refseq: NP_004453
MIM: 184420
Uniprot ID: P37268
Chromosome Location: 8p23.1-p22
Pathway: Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, FPP => cholesterol, organism-specific biosystem; Cholesterol biosynthesis, FPP =>
Function: farnesyl-diphosphate farnesyltransferase activity; oxidoreductase activity; squalene synthase activity; transferase activity, transferring alkyl or aryl (other than methyl) groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.