"FKBP3" Related Products

Expand
Expand
Expand

Recombinant Human FKBP3

Cat.No.: FKBP3-28915TH
Product Overview: Recombinant full length Human FKBP25; amino acids 1-224, Predicted mwt: 25 kDa;
Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAE HKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISK VSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAK PSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKK GQPDAKIPPNAKLTFEVELVDID
Gene Name: FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
Official Symbol: FKBP3
Synonyms: FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase;
Gene ID: 2287
mRNA Refseq: NM_002013
Protein Refseq: NP_002004
MIM: 186947
Uniprot ID: Q00688
Chromosome Location: 14q21.2
Pathway: Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function: FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.