Recombinant Human FLT3LG
Cat.No. : | FLT3LG-28905TH |
Product Overview : | Recombinant full length extracellular domain of Human Flt3 Ligand protein expressed in modified Human 293 cells, amino acids 27-184. |
- Specification
- Gene Information
- Related Products
Description : | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al. |
Biological activity : | Activity:The ED50 of FLT3LG-28905TH is typically between 0.5 -5.0 ng/ml as measured in a cell proliferation assay using the OCI/AML5 Human leukemia cell line. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:TQDCSFQHSPISSDFAVKIRELSDYLLQD YPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSK MQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQE TSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSP RPLEATAPTAPAS |
Gene Name : | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
Official Symbol : | FLT3LG |
Synonyms : | FLT3LG; fms-related tyrosine kinase 3 ligand; |
Gene ID : | 2323 |
mRNA Refseq : | NM_001204502 |
Protein Refseq : | NP_001191431 |
MIM : | 600007 |
Uniprot ID : | P49771 |
Chromosome Location : | 19q13.3 |
Pathway : | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function : | cytokine activity; receptor binding; |
Products Types
◆ Recombinant Protein | ||
FLT3LG-16H | Active Recombinant Human FLT3LG Protein, Animal Free | +Inquiry |
FLT3LG-100H | Active Recombinant Human FLT3LG Protein | +Inquiry |
FLT3LG-5423H | Recombinant Human Fms-Related Tyrosine Kinase 3 Ligand, His-tagged | +Inquiry |
FLT3LG-001H | Recombinant Human FLT3LG Protein, GST-tagged | +Inquiry |
Flt3l-96M | Recombinant Active Mouse FLT3LG Protein, His-tagged(C-ter) | +Inquiry |
◆ Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket