Recombinant Human FMNL1, His-tagged
Cat.No. : | FMNL1-26305TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 848-1100 of Human FMNL1 with N terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. An alternative splice variant has been described but its full length sequence has not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVI AEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRG LELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTA QEAFESVVEYFGENPKTTSPGLFFSLFSRFIKAYKKAE QEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMD LISELKRRQQKEPLIYESDRDGAIEDIITVIKTVPFTA RTGKRTSRLLCEASLGEEMPL |
Gene Name : | FMNL1 formin-like 1 [ Homo sapiens ] |
Official Symbol : | FMNL1 |
Synonyms : | FMNL1; formin-like 1; C17orf1B, FMNL, formin like; formin-like protein 1; C17orf1; |
Gene ID : | 752 |
mRNA Refseq : | NM_005892 |
Protein Refseq : | NP_005883 |
MIM : | 604656 |
Uniprot ID : | O95466 |
Chromosome Location : | 17q21.31 |
Function : | Rho GTPase binding; actin binding; binding; molecular_function; profilin binding; |
Products Types
◆ Recombinant Protein | ||
Fmnl1-3050M | Recombinant Mouse Fmnl1 Protein, Myc/DDK-tagged | +Inquiry |
FMNL1-4388H | Recombinant Human FMNL1 Protein, GST-tagged | +Inquiry |
FMNL1-2432H | Recombinant Human FMNL1 Protein, MYC/DDK-tagged | +Inquiry |
FMNL1-926H | Recombinant Human FMNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FMNL1-412H | Recombinant Human FMNL1 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
FMNL1-658HCL | Recombinant Human FMNL1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All FMNL1 Products
Required fields are marked with *
My Review for All FMNL1 Products
Required fields are marked with *
0
Inquiry Basket