"FN3KRP" Related Products

Expand
Expand

Recombinant Human FN3KRP, His-tagged

Cat.No.: FN3KRP-29895TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-309 of Human Ketosamine-3-kinase with N terminal His tag; Predicted MWt 35 kDa.
Description: FN3KRP and FN3K (MIM 608425) protect proteins from nonenzymatic glycation by phosphorylating the modified amino acid. This phosphorylation destabilizes the sugar-amine linkage and leads to spontaneous decomposition (Conner et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 84 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFV KVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLD APGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKK LGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYL PQVNDWQEDWVVFYARQRIQPQMDMVEKESGDREALQLWS ALQLKIPDLFRDLEIIPALLHGDLWGGNVAEDSSGPVI FDPASFYGHSEYELAIAGMFGGFSSSFYSAYHGKIPKA PGFEKRLQLYQLFHYLNHWNHFGSGYRGSSLNIMRNLV K
Gene Name: FN3KRP fructosamine 3 kinase related protein [ Homo sapiens ]
Official Symbol: FN3KRP
Synonyms: FN3KRP; fructosamine 3 kinase related protein; ketosamine-3-kinase; FLJ12171; FN3KL;
Gene ID: 79672
mRNA Refseq: NM_024619
Protein Refseq: NP_078895
MIM: 611683
Uniprot ID: Q9HA64
Chromosome Location: 17q25
Function: kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.