"FUT8" Related Products

Expand
Expand
Expand

Recombinant Human FUT8

Cat.No.: FUT8-27230TH
Product Overview: Recombinant full length Human FUT8 with N terminal proprietary tag, predicted mwt: 89.32 kDa.
Description: This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.
Protein length: 575 amino acids
Molecular Weight: 89.320kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSS RELSKILAKLERLKQQNEDLRRMAESLRIPEGPIDQGPAI GRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE NGAKELWFFLQSELKKLKNLEGNELQRHADEFLLDLGHHE RSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQN PKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT LILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVH GDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVD KKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHN RYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADE IPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE KIETVKYPTYPEAEK
Sequence Similarities: Belongs to the glycosyltransferase 23 family.Contains 1 SH3 domain.
Gene Name: FUT8 fucosyltransferase 8 (alpha (1,6) fucosyltransferase) [ Homo sapiens ]
Official Symbol: FUT8
Synonyms: FUT8; fucosyltransferase 8 (alpha (1,6) fucosyltransferase); alpha-(1,6)-fucosyltransferase;
Gene ID: 2530
mRNA Refseq: NM_004480
Protein Refseq: NP_004471
MIM: 602589
Uniprot ID: Q9BYC5
Chromosome Location: 14q24.3
Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem;
Function: SH3 domain binding; glycoprotein 6-alpha-L-fucosyltransferase activity; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.