"GAD2" Related Products

Expand
Expand
Expand

Recombinant Human GAD2

Cat.No.: GAD2-26072TH
Product Overview: Recombinant full length Human GAD65 with N terminal proprietary tag; Predicted MWt 90.42 kDa.
Description: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.
Protein length: 585 amino acids
Molecular Weight: 90.420kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGI GNKLCALLYGDAEKPAESGGSQPPRAAARKAACACDQK PCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNIL LQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNL EEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWL TSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGS GDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAALPRLI AFTSEHSHFSLKKGAAALGIGTDSVILIKCDERGKMIP SDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVAD ICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSV TWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQD KHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFE AHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWY IPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVS YQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
Sequence Similarities: Belongs to the group II decarboxylase family.
Gene Name: GAD2 glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) [ Homo sapiens ]
Official Symbol: GAD2
Synonyms: GAD2; glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa); glutamate decarboxylase 2 (pancreatic islets and brain, 65kD); glutamate decarboxylase 2; GAD65;
Gene ID: 2572
mRNA Refseq: NM_000818
Protein Refseq: NP_000809
MIM: 138275
Uniprot ID: Q05329
Chromosome Location: 10p13-p11.2
Pathway: Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Butanoate metabolism, organism-specific biosystem;
Function: carboxy-lyase activity; glutamate decarboxylase activity; lyase activity; protein binding; pyridoxal phosphate binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.