"GFAP" Related Products

Expand
Expand

Recombinant Human GFAP

Cat.No.: GFAP-29017TH
Product Overview: Recombinant full length Human GFAP (amino acids 1-432) with a N terminal proprietary tag; predicted MWt 73.59kDa inclusive of tag.
Description: This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein length: 432 amino acids
Molecular Weight: 73.590kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in cells lacking fibronectin.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLA RMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRF ASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETN LRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVRE AASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
Sequence Similarities: Belongs to the intermediate filament family.
Gene Name: GFAP glial fibrillary acidic protein [ Homo sapiens ]
Official Symbol: GFAP
Synonyms: GFAP; glial fibrillary acidic protein; FLJ45472; intermediate filament protein;
Gene ID: 2670
mRNA Refseq: NM_001131019
Protein Refseq: NP_001124491
MIM: 137780
Uniprot ID: P14136
Chromosome Location: 17q21
Function: integrin binding; structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.