"GLA" Related Products

Expand
Expand
Expand

Recombinant Human GLA

Cat.No.: GLA-28966TH
Product Overview: Recombinant full length Human Galactosidase alpha with a N terminal proprietary tag; predicted MWt 72.93 kDa inclusive of tag. AAH02689
Description: This gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.
Protein length: 429 amino acids
Molecular Weight: 72.930kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTP TMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEG WKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFA DWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVY SCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQ VTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAIN QDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWT SRLRSHINPTGTVLLQLENTMQMSLKDLL
Gene Name: GLA galactosidase, alpha [ Homo sapiens ]
Official Symbol: GLA
Synonyms: GLA; galactosidase, alpha; alpha-galactosidase A; GALA;
Gene ID: 2717
mRNA Refseq: NM_000169
Protein Refseq: NP_000160
MIM: 300644
Uniprot ID: P06280
Chromosome Location: Xq21.3-q22
Pathway: Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Glycosphingolipid biosynthesis - globo series, organism-specific biosystem;
Function: alpha-galactosidase activity; alpha-galactosidase activity; catalytic activity; cation binding; galactoside binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.