"GLDC" Related Products

Expand

Recombinant Human GLDC

Cat.No.: GLDC-29067TH
Product Overview: Recombinant fragment of Human GLDC protein with an N terminal proprietary tag; Predicted MW 36.52 kDa.
Description: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
Sequence Similarities: Belongs to the gcvP family.
Gene Name: GLDC glycine dehydrogenase (decarboxylating) [ Homo sapiens ]
Official Symbol: GLDC
Synonyms: GLDC; glycine dehydrogenase (decarboxylating); glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavage system protein P); glycine dehydrogenase [decarboxylating], mitochondrial; GCSP; glycine cleavage system protein P; glycine deca
Gene ID: 2731
mRNA Refseq: NM_000170
Protein Refseq: NP_000161
MIM: 238300
Uniprot ID: P23378
Chromosome Location: 9p22
Pathway: Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: electron carrier activity; glycine dehydrogenase (decarboxylating) activity; lyase activity; oxidoreductase activity; pyridoxal phosphate binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.