"GLOD4" Related Products

Expand
Expand

Recombinant Human GLOD4

Cat.No.: GLOD4-27651TH
Product Overview: Recombinant full length Human GLOD4 expressed in Saccharomyces cerevisiae; amino acids 1-298, 298 amino acids, MWt 33.2 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: GLOD4, also known glyoxalase domain-containing protein 4, is an enzyme that belongs to the glyoxalase system.
Tissue specificity: Expressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEG CKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVG DYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFE TEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWC NLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVD HAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSL DTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGS KLLDDAMSADKSDEWFAKHNKPKASG
Sequence Similarities: Belongs to the glyoxalase I family.
Gene Name: GLOD4 glyoxalase domain containing 4 [ Homo sapiens ]
Official Symbol: GLOD4
Synonyms: GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71;
Gene ID: 51031
mRNA Refseq: NM_016080
Protein Refseq: NP_057164
Uniprot ID: Q9HC38
Chromosome Location: 17p13.3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.