"GNRH1" Related Products

Expand
Expand
Expand

Recombinant Human GNRH1

Cat.No.: GNRH1-28077TH
Product Overview: Recombinant full length Human GnRH with a proprietary tag; Predicted MWt 36.12.
Description: The protein encoded by this gene is secreted and then cleaved to form the 10 aa luteinizing hormone-releasing hormone (LHRH), also known as gonadoliberin-1, and prolactin release-inhibiting factor, also known as GnRH-associated peptide 1. LHRH stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Two transcript variants encoding the same protein have been found for this gene.
Protein length: 92 amino acids
Molecular Weight: 36.120kDa inclusive of tags
Source: Wheat germ
Biological activity: useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Gene Name: GNRH1 gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) [ Homo sapiens ]
Official Symbol: GNRH1
Synonyms: GNRH1; gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); GNRH, gonadotropin releasing hormone 1 (leutinizing releasing hormone) , GRH, LHRH; progonadoliberin-1;
Gene ID: 2796
mRNA Refseq: NM_000825
Protein Refseq: NP_000816
MIM: 152760
Uniprot ID: P01148
Chromosome Location: 8p21-p11.2
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GnRH signaling pathway, organism-specific biosystem;
Function: gonadotropin hormone-releasing hormone activity; hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.