"GOT1" Related Products

Expand
Expand

Recombinant Human GOT1, His-tagged

Cat.No.: GOT1-27058TH
Product Overview: Recombinant full length Human Aspartate Aminotransferase fused to His Tag at N-terminus; 433aa, 48.4kDa.
Description: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively.GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Protein length: 413 amino acids
Conjugation: HIS
Molecular Weight: 48.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 0.58% Sodium chloride, 20% Glycerol
Storage: Store at 4°C or at -20°C for long term storage.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAPPSVFAEVPQAQPVLVFK LTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQK IANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKR VGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPT WENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLEN APEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFP FFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKN FGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPP AQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRA RLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHI YLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Sequence Similarities: Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
Gene Name: GOT1 glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) [ Homo sapiens ]
Official Symbol: GOT1
Synonyms: GOT1; glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1); aspartate aminotransferase, cytoplasmic;
Gene ID: 2805
mRNA Refseq: NM_002079
Protein Refseq: NP_002070
MIM: 138180
Uniprot ID: P17174
Chromosome Location: 10q24.1-q25.1
Pathway: Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Amino acid synthesis and interconversion (transamination), organism-specific biosystem; Arginine and proline metabolism, organism-specific biosystem;
Function: L-aspartate:2-oxoglutarate aminotransferase activity; L-aspartate:2-oxoglutarate aminotransferase activity; L-aspartate:2-oxoglutarate aminotransferase activity; L-phenylalanine:2-oxoglutarate aminotransferase activity; carboxylic acid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.