"GPC3" Related Products

Expand
Expand
Expand

Recombinant Human GPC3

Cat.No.: GPC3-27455TH
Product Overview: Recombinant fragment corresponding to amino acids 121-220 of Human Glypican 3 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in lung, liver and kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS
Sequence Similarities: Belongs to the glypican family.
Gene Name: GPC3 glypican 3 [ Homo sapiens ]
Official Symbol: GPC3
Synonyms: GPC3; glypican 3; SDYS; glypican-3; DGSX; glypican proteoglycan 3; OCI 5; SGB; SGBS; SGBS1;
Gene ID: 2719
mRNA Refseq: NM_001164617
Protein Refseq: NP_001158089
MIM: 300037
Uniprot ID: P51654
Chromosome Location: Xq26
Pathway: Glypican 3 network, organism-specific biosystem; Glypican pathway, organism-specific biosystem;
Function: heparan sulfate proteoglycan binding; peptidyl-dipeptidase inhibitor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.