Recombinant Human GPX7
| Cat.No. : | GPX7-29079TH |
| Product Overview : | Recombinant full length Human Glutathione Peroxidase 7 with N terminal proprietary tag. Predicted MW 46.64 kDa. |
- Specification
- Gene Information
- Related Products
| Protein length : | 187 amino acids |
| Molecular Weight : | 46.640kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSL EKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN VLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWD PTVSVEEVRPQITALVRKLILLKREDL |
| Sequence Similarities : | Belongs to the glutathione peroxidase family. |
| Gene Name : | GPX7 glutathione peroxidase 7 [ Homo sapiens ] |
| Official Symbol : | GPX7 |
| Synonyms : | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx; |
| Gene ID : | 2882 |
| mRNA Refseq : | NM_015696 |
| Protein Refseq : | NP_056511 |
| Uniprot ID : | Q96SL4 |
| Chromosome Location : | 1p32 |
| Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; glutathione redox reactions I, organism-specific biosystem; |
| Function : | glutathione peroxidase activity; oxidoreductase activity; |
Products Types
| ◆ Recombinant Protein | ||
| GPX7-5314H | Recombinant Human GPX7 Protein, GST-tagged | +Inquiry |
| GPX7-1787R | Recombinant Rhesus Macaque GPX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPX7-2234H | Recombinant Human GPX7 Protein, MYC/DDK-tagged | +Inquiry |
| Gpx7-3300M | Recombinant Mouse Gpx7 Protein, Myc/DDK-tagged | +Inquiry |
| GPX7-7341H | Recombinant Human GPX7, Fc tagged | +Inquiry |
| ◆ Lysates | ||
| GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
