"GSS" Related Products

Expand
Expand

Recombinant Human GSS, His-tagged

Cat.No.: GSS-26092TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-474 of Human Glutathione Synthetase with N terminal His tag, MWt 56kDa.
Description: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 41 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPT SSEVVSYAPFTLFPSLVPSALLEQAYAVQMDFNLLVDA VSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIA QTVFLGLNRSDYMFQRSADGSPALKQIEINTISASFGG LASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAK AWELYGSPNALVLLIAQEKERNIFDQRAIENELLARNI HVIRRTFEDISEKGSLDQDRRLFVDGQEIAVVYFRDGY MPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQ QELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEE GDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQL KDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCIS ELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVA AGVAVLDNPYPV
Sequence Similarities: Belongs to the eukaryotic GSH synthase family.
Gene Name: GSS glutathione synthetase [ Homo sapiens ]
Official Symbol: GSS
Synonyms: GSS; glutathione synthetase;
Gene ID: 2937
mRNA Refseq: NM_000178
Protein Refseq: NP_000169
MIM: 601002
Uniprot ID: P48637
Chromosome Location: 20q11.2
Pathway: Biological oxidations, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, conserved biosystem;
Function: ATP binding; glutathione binding; glutathione synthase activity; glycine binding; ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.