Recombinant Human HACL1, His-tagged
Cat.No. : | HACL1-26022TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 393-578 of Human 2 Hydroxy phytanoyl CoA lyase with N terminal His tag; MWt 22kDa. |
- Specification
- Gene Information
- Related Products
Description : | By analyzing 1,780,295 5-end sequences of human full-length cDNAs derived from 164 kinds of oligo-cap cDNA libraries, we identified 269,774 independent positions of transcriptional start sites (TSSs) for 14,628 human RefSeq genes. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FVVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTMGVGLGF AIAAAVVAKDRSPGQWIICVEGDSAFGFSGMEVETICR YNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVP PMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSL ADTTKPSLINIMIEPQATRKAQDFHWLTRSNM |
Gene Name : | HACL1 2-hydroxyacyl-CoA lyase 1 [ Homo sapiens ] |
Official Symbol : | HACL1 |
Synonyms : | HACL1; 2-hydroxyacyl-CoA lyase 1; 2 hydroxyphytanoyl CoA lyase , HPCL; 2 HPCL; PHYH2; |
Gene ID : | 26061 |
mRNA Refseq : | NM_012260 |
Protein Refseq : | NP_036392 |
MIM : | 604300 |
Uniprot ID : | Q9UJ83 |
Chromosome Location : | 3p24.3 |
Pathway : | Alpha-oxidation of phytanate, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Peroxisomal lipid metabolism, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; |
Function : | carbon-carbon lyase activity; carbon-carbon lyase activity; identical protein binding; magnesium ion binding; thiamine pyrophosphate binding; |
Products Types
◆ Recombinant Protein | ||
HACL1-4050M | Recombinant Mouse HACL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HACL1-33H | Recombinant Human HACL1 Protein, His-tagged | +Inquiry |
Hacl1-3351M | Recombinant Mouse Hacl1 Protein, Myc/DDK-tagged | +Inquiry |
HACL1-1040H | Recombinant Human HACL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HACL1-4553H | Recombinant Human HACL1 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
HACL1-5647HCL | Recombinant Human HACL1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket