"HAX1" Related Products

Expand
Expand

Recombinant Human HAX1, His-tagged

Cat.No.: HAX1-29183TH
Product Overview: Recombinant fragment, corresponding to amino acids 65-231 of Human HAX1 Isoform 5 with N terminal His tag; MWt 22 kDa.
Description: The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 98 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSE SPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQ VSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRT VVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR
Gene Name: HAX1 HCLS1 associated protein X-1 [ Homo sapiens ]
Official Symbol: HAX1
Synonyms: HAX1; HCLS1 associated protein X-1; HCLS1-associated protein X-1; HCLS1 (and PKD2) associated protein; HCLSBP1; HS1BP1;
Gene ID: 10456
mRNA Refseq: NM_001018837
Protein Refseq: NP_001018238
MIM: 605998
Uniprot ID: O00165
Chromosome Location: 1q21.3
Function: interleukin-1 binding; protein N-terminus binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.