Recombinant Human HES1
Cat.No. : | HES1-27078TH |
Product Overview : | Recombinant fragment corresponding to amino acids 36-142 of Human Hes1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. |
Protein length : | 107 amino acids |
Molecular Weight : | 37.400kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKL EKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFS ECMNEVTRFLSTCEGVNTEVRTRLLGH |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain. |
Gene Name : | HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ] |
Official Symbol : | HES1 |
Synonyms : | HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; |
Gene ID : | 3280 |
mRNA Refseq : | NM_005524 |
Protein Refseq : | NP_005515 |
MIM : | 139605 |
Uniprot ID : | Q14469 |
Chromosome Location : | 3q28-q29 |
Pathway : | ATF-2 transcription factor network, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; |
Function : | DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
HES1-4699H | Recombinant Human HES1 Protein, GST-tagged | +Inquiry |
HES1-1062H | Recombinant Human HES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES1-4131M | Recombinant Mouse HES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hes1-1111M | Recombinant Mouse Hes1 Protein, MYC/DDK-tagged | +Inquiry |
HES1-2484R | Recombinant Rat HES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
HES1-5582HCL | Recombinant Human HES1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket