"HEXA" Related Products

Expand
Expand
Expand

Recombinant Human HEXA

Cat.No.: HEXA-26087TH
Product Overview: Recombinant full length Human HEXA with a N terminal proprietary tag; Predicted MWt 89.93 kDa including the tag.
Description: This gene encodes the alpha subunit of the lysosomal enzyme beta-hexosaminidase that, together with the cofactor GM2 activator protein, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Beta-hexosaminidase is composed of two subunits, alpha and beta, which are encoded by separate genes. Both beta-hexosaminidase alpha and beta subunits are members of family 20 of glycosyl hydrolases. Mutations in the alpha or beta subunit genes lead to an accumulation of GM2 ganglioside in neurons and neurodegenerative disorders termed the GM2 gangliosidoses. Alpha subunit gene mutations lead to Tay-Sachs disease (GM2-gangliosidosis type I).
Protein length: 529 amino acids
Molecular Weight: 83.930kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLY PNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPR PYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTI NDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTE IEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNV FHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVK EVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSG SEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLG GDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLL DIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNY MKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYVVEPL AFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV AERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVG FCEQEFEQT
Sequence Similarities: Belongs to the glycosyl hydrolase 20 family.
Gene Name: HEXA hexosaminidase A (alpha polypeptide) [ Homo sapiens ]
Official Symbol: HEXA
Synonyms: HEXA; hexosaminidase A (alpha polypeptide); beta-hexosaminidase subunit alpha; GM2 gangliosidosis; Tay Sachs disease;
Gene ID: 3073
mRNA Refseq: NM_000520
Protein Refseq: NP_000511
MIM: 606869
Uniprot ID: P06865
Chromosome Location: 15q24.1
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem; Glycosaminoglycan degradation, conserved biosystem; Glycosphingolipid biosynthesis - ganglio series, organism-specific biosystem;
Function: beta-N-acetylhexosaminidase activity; cation binding; hydrolase activity, hydrolyzing O-glycosyl compounds; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.