Recombinant Human HLF, His-tagged
Cat.No. : | HLF-27715TH |
Product Overview : | Recombinant full length Human HLF (amino acids 1-295 ) with a N terminal His tag. 315 amino acids with a predicted MWt 35.3 kDa including tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to activate transcription. Chromosomal translocations fusing portions of this gene with the E2A gene cause a subset of childhood B-lineage acute lymphoid leukemias. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Protein length : | 295 amino acids |
Conjugation : | HIS |
Molecular Weight : | 35.300kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Highly expressed in liver; lower levels in lung and kidney. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEKMSRPLPLNPTFIPPPYG VLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPT VPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIP PSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHP GIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYE PDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKA RKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIA IRASFLEKENSALRQEVADLRKELGKCKNILAKYEARH GPL |
Sequence Similarities : | Belongs to the bZIP family. PAR subfamily.Contains 1 bZIP domain. |
Gene Name : | HLF hepatic leukemia factor [ Homo sapiens ] |
Official Symbol : | HLF |
Synonyms : | HLF; hepatic leukemia factor; MGC33822; |
Gene ID : | 3131 |
mRNA Refseq : | NM_002126 |
Protein Refseq : | NP_002117 |
MIM : | 142385 |
Uniprot ID : | Q16534 |
Chromosome Location : | 17q22 |
Function : | DNA binding; double-stranded DNA binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
HLF-1924R | Recombinant Rhesus Macaque HLF Protein, His (Fc)-Avi-tagged | +Inquiry |
HLF-4852H | Recombinant Human HLF Protein, GST-tagged | +Inquiry |
HLF-3618H | Recombinant Human HLF, His-tagged | +Inquiry |
HLF-209H | Recombinant Human HLF protein, T7/His-tagged | +Inquiry |
HLF-2103R | Recombinant Rhesus monkey HLF Protein, His-tagged | +Inquiry |
◆ Lysates | ||
HLF-5490HCL | Recombinant Human HLF 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All HLF Products
Required fields are marked with *
My Review for All HLF Products
Required fields are marked with *
0
Inquiry Basket