"HOXC8" Related Products

Expand

Recombinant Human HOXC8

Cat.No.: HOXC8-26894TH
Product Overview: Recombinant fragment of Human HOXC8 with N terminal proprietary tag, 35.53kDa.
Description: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Sequence Similarities: Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: HOXC8 homeobox C8 [ Homo sapiens ]
Official Symbol: HOXC8
Synonyms: HOXC8; homeobox C8; homeo box C8 , HOX3, HOX3A; homeobox protein Hox-C8;
Gene ID: 3224
mRNA Refseq: NM_022658
Protein Refseq: NP_073149
MIM: 142970
Uniprot ID: P31273
Chromosome Location: 12q13.13
Function: sequence-specific DNA binding transcription factor activity; transcription regulatory region sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.