"HSPB11" Related Products

Expand
Expand

Recombinant Human HSPB11, His-tagged

Cat.No.: HSPB11-27166TH
Product Overview: Recombinant full length Human C1orf41 with an N terminal His tag; 164 amino acids, predicted MWt 18.5kDa.
Description: HSPCO34 protein, chromosome 1 open reading frame 41.
Protein length: 144 amino acids
Conjugation: HIS
Molecular Weight: 18.500kDa inclusive of tags
Source: E. coli
Tissue specificity: Detected in placenta.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Gene Name: HSPB11 heat shock protein family B (small), member 11 [ Homo sapiens ]
Official Symbol: HSPB11
Synonyms: HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25;
Gene ID: 51668
mRNA Refseq: NM_016126
Protein Refseq: NP_057210
Uniprot ID: Q9Y547
Chromosome Location: 1p32

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.