Recombinant Human HSPB7, His-tagged
Cat.No. : | HSPB7-26656TH |
Product Overview : | Recombinant full length Human cvHSP with an N-terminal His tag; predicted MWt 20.7 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | HSPB7 is a member of HSPB (Heat shock protein beta) family. The HSPB family is one of the more diverse families within the group of HSP families. Some members have chaperone-like activities and/or play a role in cytoskeletal stabilization. |
Protein length : | 170 amino acids |
Conjugation : | HIS |
Molecular Weight : | 20.700kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSHRTSSTFRAERSFHSSSS SSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA LREDGSLTIRARRHPHTEHVQQTFRTEIKI |
Sequence Similarities : | Belongs to the small heat shock protein (HSP20) family. |
Gene Name : | HSPB7 heat shock 27kDa protein family, member 7 (cardiovascular) [ Homo sapiens ] |
Official Symbol : | HSPB7 |
Synonyms : | HSPB7; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock 27kD protein family, member 7 (cardiovascular); heat shock protein beta-7; cvHSP; |
Gene ID : | 27129 |
mRNA Refseq : | NM_014424 |
Protein Refseq : | NP_055239 |
MIM : | 610692 |
Uniprot ID : | Q9UBY9 |
Chromosome Location : | 1p36.23-p34.3 |
Function : | protein C-terminus binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Hspb7-3456M | Recombinant Mouse Hspb7 Protein, Myc/DDK-tagged | +Inquiry |
HSPB7-5118H | Recombinant Human HSPB7 Protein, GST-tagged | +Inquiry |
HSPB7-124H | Recombinant Human HSPB7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSPB7-4365M | Recombinant Mouse HSPB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPB7-2899H | Recombinant Human HSPB7, T7-tagged | +Inquiry |
◆ Lysates | ||
HSPB7-5346HCL | Recombinant Human HSPB7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket