"IFITM3" Related Products

Expand

Recombinant Human IFITM3, His-tagged

Cat.No.: IFITM3-26286TH
Product Overview: Recombinant full length Human Fragilis , with a proprietary tag and a His tag. Length with tag 379 amino acids with a predicted molecular weight of 43 kDa.
Protein length: 133 amino acids
Conjugation: HIS
Molecular Weight: 43.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: Purified via His tag
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, PBS, pH 7.4
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Sequence Similarities: Belongs to the CD225 family.
Gene Name: IFITM3 interferon induced transmembrane protein 3 [ Homo sapiens ]
Official Symbol: IFITM3
Synonyms: IFITM3; interferon induced transmembrane protein 3; interferon induced transmembrane protein 3 (1 8U); interferon-induced transmembrane protein 3; 1 8U;
Gene ID: 10410
mRNA Refseq: NM_021034
Protein Refseq: NP_066362
MIM: 605579
Uniprot ID: Q01628
Chromosome Location: 11p15.5
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.