"IFNGR1" Related Products

Expand
Expand

Recombinant Human IFNGR1, Fc-tagged

Cat.No.: IFNGR1-28503TH
Product Overview: Recombinant fragment, corresponding to the extracellular domain (amino acids 18-245) of Human IFNGR1 fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified Human 293 cells.
Description: This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Conjugation: Fc
Biological activity: The ED50 of IFNGR1 (Fc Chimera) is typically 0.05-0.1 μg/ml as measured by its ability to neutralize IFN gamma mediated cytotoxicity using the HT-29 colorectal adenocarcinoma cell line.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQ VPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGD PSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPK LDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYI RVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGGS SNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPGK
Sequence Similarities: Belongs to the type II cytokine receptor family.Contains 2 fibronectin type-III domains.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens ]
Official Symbol: IFNGR1
Synonyms: IFNGR1; interferon gamma receptor 1; IFNGR; CD119;
Gene ID: 3459
mRNA Refseq: NM_000416
Protein Refseq: NP_000407
MIM: 107470
Uniprot ID: P15260
Chromosome Location: 6q23-q24
Pathway: Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: cytokine binding; interferon-gamma receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.