"IFNGR2" Related Products

Expand
Expand
Expand

Recombinant Human IFNGR2, Fc-tagged

Cat.No.: IFNGR2-29421TH
Product Overview: Recombinant fragment, corresponding to the extracellular domain of Human IFN gamma Receptor beta , fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified Human 293 cells.
Description: This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
Conjugation: Fc
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical sequence: SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYRV QFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSA GFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVG PPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHY WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQGSSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK
Sequence Similarities: Belongs to the type II cytokine receptor family.Contains 2 fibronectin type-III domains.
Gene Name: IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) [ Homo sapiens ]
Official Symbol: IFNGR2
Synonyms: IFNGR2; interferon gamma receptor 2 (interferon gamma transducer 1); IFNGT1; interferon gamma receptor 2; AF 1;
Gene ID: 3460
mRNA Refseq: NM_005534
Protein Refseq: NP_005525
MIM: 147569
Uniprot ID: P38484
Chromosome Location: 21q22.1
Pathway: Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: interferon-gamma receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.