"IGBP1" Related Products

Expand

Recombinant Human IGBP1, His-tagged

Cat.No.: IGBP1-28033TH
Product Overview: Recombinant fragment, corresponding to amino acids 27-322 of Human IGBP1 with N terminal His tag. MWt: 34 kDa,
Description: The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitously expressed with highest levels in heart, skeletal muscle and pancreas.
Form: Lyophilised:Reconstitute with 155 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNE DLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQR AREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSS MAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESG QADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRE RDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAG YPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWD(Amino acid sequence (Sequence determined by 5 Sequencing))
Sequence Similarities: Belongs to the IGBP1/TAP42 family.
Gene Name: IGBP1 immunoglobulin (CD79A) binding protein 1 [ Homo sapiens ]
Official Symbol: IGBP1
Synonyms: IGBP1; immunoglobulin (CD79A) binding protein 1; IBP1; immunoglobulin-binding protein 1; alpha 4;
Gene ID: 3476
mRNA Refseq: NM_001551
Protein Refseq: NP_001542
MIM: 300139
Uniprot ID: P78318
Chromosome Location: Xq13.1-q13.3
Function: mitogen-activated protein kinase kinase binding; protein binding; protein phosphatase type 2A regulator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.